{"product_id":"proteintech-19896-1-ap","title":"Proteintech, 19896-1-AP, GHRH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GHRH (19896-1-AP) by Proteintech is a Polyclonal antibody targeting GHRH in IHC, ELISA applications with reactivity to human samples\n19896-1-AP targets GHRH in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGHRH, also known as GHRF, belongs to the glucagon family. GHRH is a hypothalamic peptide that stimulates synthesis and proliferation of pituitary somatotroph cells as well as secretion of growth hormone. GHRH expression is predominantly in the human hypothalamus, with some expression in the basal ganglia (PMID: 39913072). Defects in GHRH are a cause of dwarfism, while hypersecretion of GHRH is a cause of gigantism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13787 Product name: Recombinant human GHRH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-108 aa of BC098161 Sequence: PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG Predict reactive species\nFull Name: growth hormone releasing hormone\nCalculated Molecular Weight: 108 aa, 12 kDa\nGenBank Accession Number: BC098161\nGene Symbol: GHRH\nGene ID (NCBI): 2691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01286\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887650853033,"sku":"19896-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19896-1-ap","provider":"Iright","version":"1.0","type":"link"}