{"product_id":"proteintech-19910-1-ap","title":"Proteintech, 19910-1-AP, DDX17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX17 (19910-1-AP) by Proteintech is a Polyclonal antibody targeting DDX17 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19910-1-AP targets DDX17 in WB, IHC, IF\/ICC, IP, CoIP, chIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HEK-293T cells,  HEK-293 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX17, also named as DEAD box protein p72 and DEAD box protein p82, is a 729 amino acid protein, which belongs to the DEAD box helicase family. DDX5\/DBP2 subfamily. DDX17 is widely expressed. Levels tend to increase during colon cancer progression, from very low in benign hyperplastic polyps to very high in tubular and villous adenomas. DDX17 as an RNA helicase unwinds RNA and alters RNA structures through ATP binding and hydrolysis. DDX17 is involved in multiple cellular processes, including pre-mRNA splicing, alternative splicing, ribosomal RNA processing and miRNA processing, as well as transcription regulation. It Regulates the alternative splicing of exons exhibiting specific features.  identification and characterisation of p72, a novel human nuclear DEAD box protein, which shows a striking homology to p68. This antibody could detect the 72 kDa isoform and 80 kDa isoform of DDX17.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13723 Product name: Recombinant human DDX17,P72 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-729 aa of BC000595 Sequence: NLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 17\nCalculated Molecular Weight: 729 aa, 80 kDa\nObserved Molecular Weight: 72-80 kDa\nGenBank Accession Number: BC000595\nGene Symbol: DDX17\nGene ID (NCBI): 10521\nRRID: AB_10667004\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92841\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868871053481,"sku":"19910-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19910-1-ap","provider":"Iright","version":"1.0","type":"link"}