{"product_id":"proteintech-19911-1-ap","title":"Proteintech, 19911-1-AP, CHCHD7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHCHD7 (19911-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19911-1-AP targets CHCHD7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, human placenta tissue,  rat pancreas tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13735 Product name: Recombinant human CHCHD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC002546 Sequence: MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY Predict reactive species\nFull Name: coiled-coil-helix-coiled-coil-helix domain containing 7\nCalculated Molecular Weight: 97 aa, 12 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC002546\nGene Symbol: CHCHD7\nGene ID (NCBI): 79145\nRRID: AB_10666734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886501187753,"sku":"19911-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19911-1-ap","provider":"Iright","version":"1.0","type":"link"}