{"product_id":"proteintech-19919-1-ap","title":"Proteintech, 19919-1-AP, TMEM38B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM38B (19919-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM38B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n19919-1-AP targets TMEM38B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM38B encodes endoplasmic reticulum membrane monovalent cation-specific channel which is involved in the release of calcium (Ca2+) from intracellular stores. TMEM38B, also known as TRIC-B, is one of the two trimeric intracellular cation (TRIC) channels. TRIC-B deficiency causes bone disease due to defective Ca2+ release and signaling in the bone cells. (PMID: 34036147, PMID: 39385871)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13835 Product name: Recombinant human TMEM38B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-291 aa of BC000049 Sequence: ERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE Predict reactive species\nFull Name: transmembrane protein 38B\nCalculated Molecular Weight: 291 aa, 33 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC000049\nGene Symbol: TMEM38B\nGene ID (NCBI): 55151\nRRID: AB_2878623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869778563241,"sku":"19919-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19919-1-ap","provider":"Iright","version":"1.0","type":"link"}