{"product_id":"proteintech-19924-1-ap","title":"Proteintech, 19924-1-AP, METTL16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe METTL16 (19924-1-AP) by Proteintech is a Polyclonal antibody targeting METTL16 in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples\n19924-1-AP targets METTL16 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat testis tissue,  NCI-H1299 cells,  NIH\/3T3 cells,  mouse testis tissue\nPositive IHC detected in: human colon tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMethyltransferase-like protein 16 (METTL16) is a human RNA methyltransferase that installs m6A marks on U6 small nuclear RNA (U6 snRNA) and S-adenosylmethionine (SAM) synthetase pre-mRNA. METTL16 is considered a protective gene, suppressing the development of OC, HCC, and endocrine system tumors (PMID: 33237039, PMID: 33133142, PMID: 34187307). However, the high expression of METTL16 has been linked with a poor survival rate in patients with breast cancer (PMID: 33362863). METTL16 has 2 isoforms with molecular weights of 64 and 26 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13889 Product name: Recombinant human METT10D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC001213 Sequence: MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTG Predict reactive species\nFull Name: methyltransferase 10 domain containing\nCalculated Molecular Weight: 562 aa, 64 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC001213\nGene Symbol: METTL16\nGene ID (NCBI): 79066\nRRID: AB_10639364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86W50\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864827561,"sku":"19924-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19924-1-ap","provider":"Iright","version":"1.0","type":"link"}