{"product_id":"proteintech-20116-1-ap","title":"Proteintech, 20116-1-AP, NOSTRIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOSTRIN (20116-1-AP) by Proteintech is a Polyclonal antibody targeting NOSTRIN in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n20116-1-AP targets NOSTRIN in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  human placenta tissue,  mouse liver tissue,  mouse lung tissue\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human heart tissue, mouse testis tissue,  human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOSTRIN  is classically known as an endothelial cell protein that sequesters eNOS and inhibits NO production. NOSTRIN contains a single polypeptide chain of 506-aa residues of 58 kDa with an N-terminal cdc15 domain and a C-terminal SH3 domain. NOSTRIN mRNA is abundant in highly vascularized tissues such as placenta, kidney, lung, and heart, and NOSTRIN protein is expressed in vascular endothelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13989 Product name: Recombinant human NOSTRIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 122-428 aa of BC014189 Sequence: KWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKA Predict reactive species\nFull Name: nitric oxide synthase trafficker\nCalculated Molecular Weight: 506 aa, 58 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC014189\nGene Symbol: NOSTRIN\nGene ID (NCBI): 115677\nRRID: AB_10666167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IVI9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913389737,"sku":"20116-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20116-1-ap","provider":"Iright","version":"1.0","type":"link"}