{"product_id":"proteintech-20121-1-ap","title":"Proteintech, 20121-1-AP, APOBEC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOBEC2 (20121-1-AP) by Proteintech is a Polyclonal antibody targeting APOBEC2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20121-1-AP targets APOBEC2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  rat heart tissue,  rat skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: mouse heart tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAPOBEC2, also named as ARCD1 and ARP1, is a member of the activation-induced deaminase\/apolipoprotein B mRNA editing enzyme catalytic polypeptide (APOBEC) cytidine deaminase family expressed in differentiated skeletal and cardiac muscle. APOBEC family members have diverse roles by their ability to edit DNA and\/or RNA. Apobec2 is one of the oldest members of the APOBEC family, along with the lymphoid-specific activation-induced deaminase. Unlike other APOBEC family members, the enzymatic activity and substrate of Apobec2 have not been fully demonstrated, and its biologic functions remain unknown. It can be detected as 25-30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13699 Product name: Recombinant human APOBEC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-224 aa of BC047767 Sequence: MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK Predict reactive species\nFull Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC047767\nGene Symbol: APOBEC2\nGene ID (NCBI): 10930\nRRID: AB_10697687\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y235\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869515010217,"sku":"20121-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20121-1-ap","provider":"Iright","version":"1.0","type":"link"}