{"product_id":"proteintech-20146-1-ap","title":"Proteintech, 20146-1-AP, GPR81 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR81 (20146-1-AP) by Proteintech is a Polyclonal antibody targeting GPR81 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n20146-1-AP targets GPR81 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue\nPositive IHC detected in: mouse pancreas tissue, human colon tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR81 (G protein-coupled receptor 81) is one of a large family of GPRs with low affinity for hydroxy-carboxylic acid structure ligands (PMID: 24657625). Lactate functions as a signaling molecule by serving as an agonist for the GPR81, involving both autocrine and paracrine mechanisms (PMID: 31836453). Moreover, A higher molecular mass band (∼60 kDa) is present in the brain and adipose tissue. This band is also strong in the transfected HeLa cells but weak in native HeLa cells and is therefore probably a form of GPR81, possibly a glycosylated form of the receptor (PMID: 23696276).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13682 Product name: Recombinant human GPR81 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-346 aa of BC066881 Sequence: SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH Predict reactive species\nFull Name: G protein-coupled receptor 81\nCalculated Molecular Weight: 346 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC066881\nGene Symbol: GPR81\nGene ID (NCBI): 27198\nRRID: AB_2878647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXC0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998750377,"sku":"20146-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20146-1-ap","provider":"Iright","version":"1.0","type":"link"}