{"product_id":"proteintech-20149-1-ap","title":"Proteintech, 20149-1-AP, DDX51 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX51 (20149-1-AP) by Proteintech is a Polyclonal antibody targeting DDX51 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n20149-1-AP targets DDX51 in WB, IP, ELISA, IF applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  Raji cells\nPositive IP detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe DEAD-box family (DDX) consists of a group of RNA helicases with the activity to hydrolyze ATP and to unwind RNA. The major physiological role of this family was to regulate RNA metabolism including ribosome assembly, RNA splicing, and pre-rRNA processing. DDX51 was a new gene in DDX family composed of 666 amino acids. DDX51 gene was a member of RNA helicases family in charge of regulating RNA metabolism(PMID: 31966432).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13691 Product name: Recombinant human DDX51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 317-666 aa of BC040185 Sequence: GQKSLAKEQESLVQKTADGYRCLADIVVATPGRLVDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVVAAAFQSEDPADPCALLKRRQAQAVTAASTCCPQMPLQKLLFSATLTQNPEKLQQLGLHQPRLFSTGLAHRGLEDTDGDGDSGKYAFPVGLTHHYVPCSLSSKPLVVLHLVLEMGFSRVLCFTNSRENSHRLFLLVQAFGGVDVAEFSSRYGPGQRRMILKQFEQGKIQLLISTDATARGIDVQGVELVVNYDAPQYLRTYVHRVGRTARAGKTGQAFTLLLKVQERRFLRMLTEAGAPELQRHELSSKLLQPLVPRYEEALSKLEESVKEERKQRAA Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 51\nCalculated Molecular Weight: 666 aa, 72 kDa\nObserved Molecular Weight: 72-80 kDa\nGenBank Accession Number: BC040185\nGene Symbol: DDX51\nGene ID (NCBI): 317781\nRRID: AB_10665947\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N8A6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869673541801,"sku":"20149-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20149-1-ap","provider":"Iright","version":"1.0","type":"link"}