{"product_id":"proteintech-20158-1-ap","title":"Proteintech, 20158-1-AP, UBTD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBTD1 (20158-1-AP) by Proteintech is a Polyclonal antibody targeting UBTD1 in WB, ELISA applications with reactivity to human, rat samples\n20158-1-AP targets UBTD1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, MG-63 cells,  U2OS cells,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin domain-containing protein 1 (UBTD1) is highly evolutionary conserved and has been described to interact with E2 enzymes of the ubiquitin-proteasome system. Even if its biological functions remain largely unknown, UBTD1 expression is regulated by P53 and induces cellular senescence by stabilizing P53 through degradation of murine double minute 2 (MDM2).(PMID: 30804013,PMID: 33884955)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14082 Product name: Recombinant human UBTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-227 aa of BC007331 Sequence: YCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD Predict reactive species\nFull Name: ubiquitin domain containing 1\nCalculated Molecular Weight: 227 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC007331\nGene Symbol: UBTD1\nGene ID (NCBI): 80019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HAC8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887915880617,"sku":"20158-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20158-1-ap","provider":"Iright","version":"1.0","type":"link"}