{"product_id":"proteintech-20170-1-ap","title":"Proteintech, 20170-1-AP, KGA-Specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KGA-Specific (20170-1-AP) by Proteintech is a Polyclonal antibody targeting KGA-Specific in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20170-1-AP targets KGA-Specific in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue,  human heart tissue,  human brain tissue,  K-562 cells,  mouse brain tissue,  A549 cells,  HeLa cells,  rat brain tissue,  HFF cells,  MRC-5 cells\nPositive IP detected in: HEK-293 cells, HFF cells\nPositive IHC detected in: human kidney tissue, human brain tissue,  mouse brain tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hela cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLS, also named as GLS1 and KIAA0838, belongs to the glutaminase family. It catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Glutaminase-, glutamate-, and taurine-immunoreactive neurons develop neurofibrillary tangles in Alzheimer's disease.The glutaminase band in AA\/C1 cells is more intense than in HT29 cells, in accordance with measurements of glutaminase activity, and had the same molecular mass of approx 63 kDa. The bands for both cell lines are clearly different in size from both rat liver glutaminase (58 kDa) and rat kidney glutaminase (65 kDa)(PMID:12408749). It also reveals a molecular weight of 83-84 kDa as a phosphate-dependent glutaminase(PMID:447624;7512428). It has 3 isoforms produced by alternative splicing named as KGA, GAM, GAC. This antibody is specific to KGA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14002 Product name: Recombinant human GLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 616-669 aa of BC038507 Sequence: KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL Predict reactive species\nFull Name: glutaminase\nCalculated Molecular Weight: 669 aa, 73 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC038507\nGene Symbol: GLS\nGene ID (NCBI): 2744\nRRID: AB_10665373\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869546153,"sku":"20170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20170-1-ap","provider":"Iright","version":"1.0","type":"link"}