{"product_id":"proteintech-20171-1-ap","title":"Proteintech, 20171-1-AP, GLS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLS2 (20171-1-AP) by Proteintech is a Polyclonal antibody targeting GLS2 in WB, IHC, ELISA applications with reactivity to human samples\n20171-1-AP targets GLS2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLS2, also named as GA and GLS, belongs to the glutaminase family. It is Glutaminase liver isoform . GLS2 plays an important role in the regulation of glutamine catabolism. It promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. GLS2 may play a role in preventing tumor proliferation. This antibody is specific to GLS2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14003 Product name: Recombinant human GLS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC059370 Sequence: MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDQ Predict reactive species\nFull Name: glutaminase 2 (liver, mitochondrial)\nCalculated Molecular Weight: 602 aa, 66 kDa\nObserved Molecular Weight: 66-70 kDa\nGenBank Accession Number: BC059370\nGene Symbol: GLS2\nGene ID (NCBI): 27165\nRRID: AB_3085600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UI32\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887652229289,"sku":"20171-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20171-1-ap","provider":"Iright","version":"1.0","type":"link"}