{"product_id":"proteintech-20190-1-ap","title":"Proteintech, 20190-1-AP, GPR105 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR105 (20190-1-AP) by Proteintech is a Polyclonal antibody targeting GPR105 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n20190-1-AP targets GPR105 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR105 (also known as P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). Notably, GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14105 Product name: Recombinant human GPR105 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-338 aa of BC034989 Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL Predict reactive species\nFull Name: purinergic receptor P2Y, G-protein coupled, 14\nCalculated Molecular Weight: 338 aa, 39 kDa\nGenBank Accession Number: BC034989\nGene Symbol: P2RY14\nGene ID (NCBI): 9934\nRRID: AB_10693612\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15391\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869688811689,"sku":"20190-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20190-1-ap","provider":"Iright","version":"1.0","type":"link"}