{"product_id":"proteintech-20191-1-ap","title":"Proteintech, 20191-1-AP, P2RY11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P2RY11 (20191-1-AP) by Proteintech is a Polyclonal antibody targeting P2RY11 in WB, ELISA applications with reactivity to human samples\n20191-1-AP targets P2RY11 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2Y purinoceptor 11 (P2RY11) is a receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. It is not activated by UTP or UDP (PMID: 9405388). Expression of P2RY11 has been detected in immune cells including dendritic cells, macrophages and non‐immune cells including cancer cells (PMID: 33463722). It is involved in immune regulation (PMID: 27246167). No murine P2ry11 has been identified.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14106 Product name: Recombinant human P2RY11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-213 aa of BC009877 Sequence: HIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ Predict reactive species\nFull Name: purinergic receptor P2Y, G-protein coupled, 11\nCalculated Molecular Weight: 374 aa, 40 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC009877\nGene Symbol: P2RY11\nGene ID (NCBI): 5032\nRRID: AB_3669328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96G91\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887748599977,"sku":"20191-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20191-1-ap","provider":"Iright","version":"1.0","type":"link"}