{"product_id":"proteintech-20288-1-ap","title":"Proteintech, 20288-1-AP, FUT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUT2 (20288-1-AP) by Proteintech is a Polyclonal antibody targeting FUT2 in WB, ELISA applications with reactivity to human samples\n20288-1-AP targets FUT2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFucosyltransferase 2 (FUT2) is a key enzyme that catalyzes the transfer of fucose to the terminal galactose of type 1 or type 2 disaccharide via α1,2-linkage. FUT2 gene codes for the alpha(1,2)fucosyltransferase responsible for the synthesis of the H antigen, which is the precursor of the ABO histo-blood group antigens in body fluids and on the intestinal mucosa (PMID: 19487333). FUT2 is highly expressed in lung adenocarcinoma (LUAD) and plays a vital role in the tumorigenesis of LUAD (PMID: 36552800).  FUT2 has a calculated molecular mass of ~39 kDa, and the 70kDa band might be the glycosylated form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14047 Product name: Recombinant human FUT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-153 aa of BC001899 Sequence: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCS Predict reactive species\nFull Name: fucosyltransferase 2 (secretor status included)\nCalculated Molecular Weight: 343 aa, 39 kDa\nObserved Molecular Weight: 35-39 kDa\nGenBank Accession Number: BC001899\nGene Symbol: FUT2\nGene ID (NCBI): 2524\nRRID: AB_3669331\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q10981\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644496041,"sku":"20288-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20288-1-ap","provider":"Iright","version":"1.0","type":"link"}