{"product_id":"proteintech-20292-1-ap","title":"Proteintech, 20292-1-AP, MLN64 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MLN64 (20292-1-AP) by Proteintech is a Polyclonal antibody targeting MLN64 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20292-1-AP targets MLN64 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells, mouse placenta tissue,  MCF-7 cells,  A549 cells,  Jurkat cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMLN64 (also known as STARD3) is an integral membrane protein anchored in late endosomes. MLN64 has a StAR-related lipid-transfer (START) domain to bind cholesterol, mediating intracellular cholesterol transfer. MLN64 is widely expressed in multiple tissues including liver, spleen, heart, kidney, lung, and the brain. Higher expression of MLN64 has been found in several malignancies. MLN64 can be detected as 33 kDa truncated fragment (PMID:9237999, PMID:15718238).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14061 Product name: Recombinant human MLN64,STARD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-445 aa of BC008747 Sequence: DFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA Predict reactive species\nFull Name: StAR-related lipid transfer (START) domain containing 3\nCalculated Molecular Weight: 445 aa, 51 kDa\nObserved Molecular Weight: 33-53 kDa\nGenBank Accession Number: BC008747\nGene Symbol: MLN64\/STARD3\nGene ID (NCBI): 10948\nRRID: AB_10643978\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14849\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869472903337,"sku":"20292-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20292-1-ap","provider":"Iright","version":"1.0","type":"link"}