{"product_id":"proteintech-20302-1-ap","title":"Proteintech, 20302-1-AP, SLC13A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC13A4 (20302-1-AP) by Proteintech is a Polyclonal antibody targeting SLC13A4 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20302-1-AP targets SLC13A4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC13A4 (also known as SUT-1 or NaS2) belongs to the family of Na+-coupled anion transporters and mediates sulfate reabsorption in the high endothelial venules (HEV). Sulfate is an obligate nutrient for fetal development. Highly expressed in placenta, SLC13A4 has been proposed to play important physiological roles in maintaining high maternal serum sulfate levels during pregnancy and mediating sulfate supply to the fetus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14116 Product name: Recombinant human SLC13A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-285 aa of BC030689 Sequence: LLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTRSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTII Predict reactive species\nFull Name: solute carrier family 13 (sodium\/sulfate symporters), member 4\nCalculated Molecular Weight: 626 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC030689\nGene Symbol: SLC13A4\nGene ID (NCBI): 26266\nRRID: AB_10793722\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKG4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869601976489,"sku":"20302-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20302-1-ap","provider":"Iright","version":"1.0","type":"link"}