{"product_id":"proteintech-20310-1-ap","title":"Proteintech, 20310-1-AP, DRD5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DRD5 (20310-1-AP) by Proteintech is a Polyclonal antibody targeting DRD5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n20310-1-AP targets DRD5 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDRD5, is a G-protein coupled receptor and involved in diversified physiological and pathological processes. this receptor stimulates adenylyl cyclase activity and is expressed in the limbic area of the mammalian brain(PMID:14699430). Studies have shown that DRD5 is highly expressed in colonic macrophages and DRD5 deficiency exacerbates DSS(dextran sodium sulfate)-induced colitis(PMID:34001860). in addition, DRD5 agonists were potent inhibitors of pituitary tumor growth(PMID:28613975).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14145 Product name: Recombinant human DRD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-477 aa of BC009748 Sequence: NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH Predict reactive species\nFull Name: dopamine receptor D5\nCalculated Molecular Weight: 477 aa, 53 kDa\nObserved Molecular Weight: 50-53 kDa\nGenBank Accession Number: BC009748\nGene Symbol: DRD5\nGene ID (NCBI): 1816\nRRID: AB_10699880\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21918\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924203177,"sku":"20310-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20310-1-ap","provider":"Iright","version":"1.0","type":"link"}