{"product_id":"proteintech-20312-1-ap","title":"Proteintech, 20312-1-AP, NDUFA9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA9 (20312-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20312-1-AP targets NDUFA9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  rat heart tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFA9(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial) is also named as NDUFS2L, CI-39kD and belongs to the complex I NDUFA9 subunit family. It is involved in stabilizing the junction between membrane and matrix arms of complex I, a late assembly step critical for complex I biogenesis and activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14150 Product name: Recombinant human NDUFA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC009311 Sequence: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLL Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa\nCalculated Molecular Weight: 377 aa, 43 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC009311\nGene Symbol: NDUFA9\nGene ID (NCBI): 4704\nRRID: AB_10694678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16795\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868863058089,"sku":"20312-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20312-1-ap","provider":"Iright","version":"1.0","type":"link"}