{"product_id":"proteintech-20315-1-ap","title":"Proteintech, 20315-1-AP, CLN6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLN6 (20315-1-AP) by Proteintech is a Polyclonal antibody targeting CLN6 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n20315-1-AP targets CLN6 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells,  HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14159 Product name: Recombinant human CLN6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-190 aa of BC010849 Sequence: IMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILF Predict reactive species\nFull Name: ceroid-lipofuscinosis, neuronal 6, late infantile, variant\nCalculated Molecular Weight: 311 aa, 36 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC010849\nGene Symbol: CLN6\nGene ID (NCBI): 54982\nRRID: AB_2878671\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWW5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869657092265,"sku":"20315-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20315-1-ap","provider":"Iright","version":"1.0","type":"link"}