{"product_id":"proteintech-20324-1-ap","title":"Proteintech, 20324-1-AP, ISCA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ISCA1 (20324-1-AP) by Proteintech is a Polyclonal antibody targeting ISCA1 in WB, ELISA applications with reactivity to human, mouse samples\n20324-1-AP targets ISCA1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse cerebellum tissue,  mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nISCA1, also named as HBLD2 and hIscA, belongs to the hesB\/iscA family. It is involved in the assembly of mitochondrial iron-sulfur proteins. ISCA1 probably involved in the binding of an intermediate of Fe\/S cluster assembly. ISCA1 plays an important role in both mitochondrial and cytosolic iron-sulfur cluster biogenesis, and a notable component of the latter is the interaction between ISCA1 and IOP1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14188 Product name: Recombinant human ISCA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC002675 Sequence: MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI Predict reactive species\nFull Name: iron-sulfur cluster assembly 1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 129 aa, 14 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC002675\nGene Symbol: ISCA1\nGene ID (NCBI): 81689\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUE6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686865065,"sku":"20324-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20324-1-ap","provider":"Iright","version":"1.0","type":"link"}