{"product_id":"proteintech-20330-1-ap","title":"Proteintech, 20330-1-AP, B4GALT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe B4GALT2 (20330-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20330-1-AP targets B4GALT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  mouse brain tissue,  mouse large intestine tissue,  mouse ovary tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human colon cancer tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14046 Product name: Recombinant human B4GALT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-176 aa of BC002431 Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD Predict reactive species\nFull Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2\nCalculated Molecular Weight: 372 aa, 42 kDa\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: BC002431\nGene Symbol: B4GALT2\nGene ID (NCBI): 8704\nRRID: AB_10693615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60909\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869517369513,"sku":"20330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20330-1-ap","provider":"Iright","version":"1.0","type":"link"}