{"product_id":"proteintech-20332-1-ap","title":"Proteintech, 20332-1-AP, Adenosine A1 Receptor Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Adenosine A1 Receptor (20332-1-AP) by Proteintech is a Polyclonal antibody targeting Adenosine A1 Receptor in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n20332-1-AP targets Adenosine A1 Receptor in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, PC-12\nPositive IHC detected in: mouse brain tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADORA1, also named as RDC7, is a receptor for adenosine. It is mediated by G proteins which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species\nFull Name: adenosine A1 receptor\nCalculated Molecular Weight: 326 aa, 37 kDa\nObserved Molecular Weight: 40 and 45 kDa\nGenBank Accession Number: BC026340\nGene Symbol: Adenosine A1 Receptor\nGene ID (NCBI): 134\nRRID: AB_2878673\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30542\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991836329,"sku":"20332-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20332-1-ap","provider":"Iright","version":"1.0","type":"link"}