{"product_id":"proteintech-20335-1-ap","title":"Proteintech, 20335-1-AP, P2RY13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P2RY13 (20335-1-AP) by Proteintech is a Polyclonal antibody targeting P2RY13 in WB, IHC, ELISA applications with reactivity to human samples\n20335-1-AP targets P2RY13 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nP2RY13 (also named GPR86 or GPR94) is a G protein-coupled receptor (GPCR), which is involved in the pathogenesis of inflammation and immune disorders (PMID: 35982893). Several studies have reported that P2RY13 is a key regulator of cholesterol transport and hepatic HDL endocytosis and is involved in bone formation, remodeling, cell survival, and neuroprotection (PMID: 38045624).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14108 Product name: Recombinant human P2RY13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 253-333 aa of BC041116 Sequence: ARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG Predict reactive species\nFull Name: purinergic receptor P2Y, G-protein coupled, 13\nCalculated Molecular Weight: 354 aa, 41 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC041116\nGene Symbol: P2RY13\nGene ID (NCBI): 53829\nRRID: AB_2878674\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BPV8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869569405097,"sku":"20335-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20335-1-ap","provider":"Iright","version":"1.0","type":"link"}