{"product_id":"proteintech-20336-1-ap","title":"Proteintech, 20336-1-AP, BTG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTG3 (20336-1-AP) by Proteintech is a Polyclonal antibody targeting BTG3 in WB, ELISA applications with reactivity to human samples\n20336-1-AP targets BTG3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBTG3 (B-cell translocation gene 3) is a member of the antiproliferative BTG\/Tob gene family, which also includes BTG1, BTG2, BTG4, TOB, and TOB2. This gene family is characterized by similar N-terminal domains but divergent C-termini. BTG3 is considered a candidate tumor suppressor gene and plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. (PMID: 38714880)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14112 Product name: Recombinant human BTG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-296 aa of BC011957 Sequence: DPCEVCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH Predict reactive species\nFull Name: BTG family, member 3\nCalculated Molecular Weight: 296 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC011957\nGene Symbol: BTG3\nGene ID (NCBI): 10950\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14201\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885311905961,"sku":"20336-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20336-1-ap","provider":"Iright","version":"1.0","type":"link"}