{"product_id":"proteintech-20378-1-ap","title":"Proteintech, 20378-1-AP, TMEM176A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM176A (20378-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM176A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20378-1-AP targets TMEM176A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue\nPositive IHC detected in: mouse brain tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14194 Product name: Recombinant human TMEM176A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-203 aa of BC008303 Sequence: LAAFSTAIAALKLWNEDFRYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLL Predict reactive species\nFull Name: transmembrane protein 176A\nCalculated Molecular Weight: 235 aa, 26 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC008303\nGene Symbol: TMEM176A\nGene ID (NCBI): 55365\nRRID: AB_10697661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96HP8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887831044265,"sku":"20378-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20378-1-ap","provider":"Iright","version":"1.0","type":"link"}