{"product_id":"proteintech-20389-1-ap","title":"Proteintech, 20389-1-AP, PLEKHF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHF1 (20389-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20389-1-AP targets PLEKHF1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human kidney tissue,  human skeletal muscle tissue,  mouse lung tissue,  mouse spleen tissue,  mouse thymus tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEKHF1, also named as APPD, LAPF, and ZFYVE15, is a 279 amino acid protein, which contains one PH domain and one FYVE-type zinc finger. PLEKHF1 translocates to lysosome during apoptosis, localizing in the nucleus and cytoplsam. PLEKHF1 is highly expressed in heart and skeletal muscle and weakly expressed in brain, thymus, spleen, kidney, liver, small intestine, placenta and lung. PLEKHF1 may induce apoptosis through the lysosomal-mitochondrial pathway. PLEKHF1 modulates the protein content of the plasma membrane and was involved in different endocytosis events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14228 Product name: Recombinant human PLEKHF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-279 aa of BC002744 Sequence: FVVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS Predict reactive species\nFull Name: pleckstrin homology domain containing, family F (with FYVE domain) member 1\nCalculated Molecular Weight: 279 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC002744\nGene Symbol: PLEKHF1\nGene ID (NCBI): 79156\nRRID: AB_10666430\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S99\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869573894313,"sku":"20389-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20389-1-ap","provider":"Iright","version":"1.0","type":"link"}