{"product_id":"proteintech-20407-1-ap","title":"Proteintech, 20407-1-AP, SNRPE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPE (20407-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPE in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20407-1-AP targets SNRPE in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse placenta tissue, human placenta tissue,  human brain tissue\nPositive IHC detected in: mouse brain tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe snRNP E (SNRPE)protein is one of several proteins associated with the U family of small nuclear RNAs that are involved in RNA processing. It functions in the U7 snRNP complex that is involved in histone 3'-end processing and also associated with snRNP U1, U2, U4\/U6 and U5. This antibody raises against the full length of human SNRPE, and can recognize two bands of SNRPE, include a 9 kDa band(isoform) and a 11kDa band(SNRPE) (PMID:23246290)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14227 Product name: Recombinant human SNRPE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC002639 Sequence: MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide E\nCalculated Molecular Weight: 92 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC002639\nGene Symbol: SNRPE\nGene ID (NCBI): 6635\nRRID: AB_10699882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62304\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869431615657,"sku":"20407-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20407-1-ap","provider":"Iright","version":"1.0","type":"link"}