{"product_id":"proteintech-20414-1-ap","title":"Proteintech, 20414-1-AP, C11orf67 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C11orf67 (20414-1-AP) by Proteintech is a Polyclonal antibody targeting C11orf67 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20414-1-AP targets C11orf67 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HepG2 cells,  rat testis tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC11orf67  is predicted to be involved in positive regulation of fat cell differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14258 Product name: Recombinant human C11orf67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC002752 Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC Predict reactive species\nFull Name: chromosome 11 open reading frame 67\nCalculated Molecular Weight: 122 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC002752\nGene Symbol: C11orf67\nGene ID (NCBI): 28971\nRRID: AB_10694438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H7C9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885377900713,"sku":"20414-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20414-1-ap","provider":"Iright","version":"1.0","type":"link"}