{"product_id":"proteintech-20416-1-ap","title":"Proteintech, 20416-1-AP, SPP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPP (20416-1-AP) by Proteintech is a Polyclonal antibody targeting SPP in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n20416-1-AP targets SPP in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse liver tissue,  mouse kidney tissue,  U2OS cells\nPositive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14158 Product name: Recombinant human SPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-220 aa of BC008938 Sequence: VLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDV Predict reactive species\nFull Name: histocompatibility (minor) 13\nCalculated Molecular Weight: 377 aa, 41 kDa\nObserved Molecular Weight: 45 kDa, 100 kDa\nGenBank Accession Number: BC008938\nGene Symbol: HM13\/SPP\nGene ID (NCBI): 81502\nRRID: AB_10665421\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TCT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989771945,"sku":"20416-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20416-1-ap","provider":"Iright","version":"1.0","type":"link"}