{"product_id":"proteintech-20421-1-ap","title":"Proteintech, 20421-1-AP, PIGM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIGM (20421-1-AP) by Proteintech is a Polyclonal antibody targeting PIGM in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20421-1-AP targets PIGM in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human testis tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14245 Product name: Recombinant human PIGM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-299 aa of BC019865 Sequence: VAVAGLTFFALSFGFYYEYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGIAAFLPQL Predict reactive species\nFull Name: phosphatidylinositol glycan anchor biosynthesis, class M\nCalculated Molecular Weight: 423 aa, 49 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC019865\nGene Symbol: PIGM\nGene ID (NCBI): 93183\nRRID: AB_10734320\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3S5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887762559145,"sku":"20421-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20421-1-ap","provider":"Iright","version":"1.0","type":"link"}