{"product_id":"proteintech-20433-1-ap","title":"Proteintech, 20433-1-AP, INSR\/CD220 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INSR\/CD220 (20433-1-AP) by Proteintech is a Polyclonal antibody targeting INSR\/CD220 in WB, IP, ELISA applications with reactivity to human samples\n20433-1-AP targets INSR\/CD220 in WB, IHC, IF, IP, CoIP, Dot blot, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  HT-1080 cells,  HeLa cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe biological effects of INS are mediated by a membrane-spanning cell surface receptor that has been shown to consist of disulfide-linked alpha-subunits (135 kDa) and beta-subunits (95 kDa) that are cleaved products of a common precursor. The binding of INS to the receptor extracellular domain results in intracellular activation of a tyrosine-specific kinase activity and the generation of signals that determine the cellular response (PMID: 2369896). This antibody raised against 980-1382aa of human INS receptor can recognize full-length INS receptor precursor and INS receptor beta subunit.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, zebrafish, bovine, fish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13922 Product name: Recombinant human INSR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 968-1370 aa of BC117172 Sequence: RKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS Predict reactive species\nFull Name: INSR\nCalculated Molecular Weight: 1382 aa, 156 kDa\nObserved Molecular Weight: 190 kDa, 135 kDa, 95 kDa\nGenBank Accession Number: BC117172\nGene Symbol: INSR\nGene ID (NCBI): 3643\nRRID: AB_10646469\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06213\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855292073,"sku":"20433-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20433-1-ap","provider":"Iright","version":"1.0","type":"link"}