{"product_id":"proteintech-20440-1-ap","title":"Proteintech, 20440-1-AP, COPZ1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COPZ1 (20440-1-AP) by Proteintech is a Polyclonal antibody targeting COPZ1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples\n20440-1-AP targets COPZ1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COS-7 cells, K-562 cells,  Jurkat cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14234 Product name: Recombinant human COPZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-84 aa of BC002849 Sequence: YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY Predict reactive species\nFull Name: coatomer protein complex, subunit zeta 1\nCalculated Molecular Weight: 177 aa, 20 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC002849\nGene Symbol: COPZ1\nGene ID (NCBI): 22818\nRRID: AB_10733095\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61923\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869400715433,"sku":"20440-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20440-1-ap","provider":"Iright","version":"1.0","type":"link"}