{"product_id":"proteintech-20444-1-ap","title":"Proteintech, 20444-1-AP, C5orf44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C5orf44 (20444-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf44 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20444-1-AP targets C5orf44 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IHC detected in: human kidney tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe function of C5orf44 has not been widely studied, and is yet to be fully elucidated. The MW of this protein is 47 kDa, and this antibody specially recognises the 47 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14267 Product name: Recombinant human C5orf44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC012006 Sequence: MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQN Predict reactive species\nFull Name: chromosome 5 open reading frame 44\nCalculated Molecular Weight: 417 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC012006\nGene Symbol: C5orf44\nGene ID (NCBI): 80006\nRRID: AB_10697663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A5PLN9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885620285609,"sku":"20444-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20444-1-ap","provider":"Iright","version":"1.0","type":"link"}