{"product_id":"proteintech-20458-1-ap","title":"Proteintech, 20458-1-AP, SLC39A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A3 (20458-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A3 in IHC, ELISA applications with reactivity to human, mouse samples\n20458-1-AP targets SLC39A3 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC39A3, also known as ZIP3 (Zrt- and Irt-like protein 3), is a solute carrier family 39 (SLC39) and is critical in maintaining cellular zinc homeostasis (PMID: 32744318). SLC39A3 is a multi-pass membrane protein that belongs to the ZIP family of zinc transporters responsible for the influx of zinc into cells from the extracellular space.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14289 Product name: Recombinant human SLC39A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-180 aa of BC005869 Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 3\nCalculated Molecular Weight: 314 aa, 34 kDa\nGenBank Accession Number: BC005869\nGene Symbol: SLC39A3\nGene ID (NCBI): 29985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRY0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806828713,"sku":"20458-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20458-1-ap","provider":"Iright","version":"1.0","type":"link"}