{"product_id":"proteintech-20459-1-ap","title":"Proteintech, 20459-1-AP, ZIP8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZIP8 (20459-1-AP) by Proteintech is a Polyclonal antibody targeting ZIP8 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n20459-1-AP targets ZIP8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, mouse heart tissue,  mouse liver tissue,  mouse lung tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human kidney tissue, human placenta tissue,  mouse lung tissue,  mouse small intestine tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC39A8, also known as ZIP8, belongs to the ZIP family of metal ion transporters which function to transport zinc and\/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Recently it was found that ZIP8 expression is upregulated in human monocytes in response to LPS, TNF-α, and live bacteria, facilitating cytoprotection during the early inflammation. Besides zinc ZIP8 can also transport cadmium and manganese efficiently. It is predicted that ZIP8 contains 3 potential N-linked glycosylation sites and is subject to glycosylation, which may account for the presences of multiple molecular weights, such as 43 kDa, 49 kDa, 60 kDa, 75-90 kDa, 150 kDa, and 200 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14292 Product name: Recombinant human SLC39A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-143 aa of BC012125 Sequence: LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 8\nCalculated Molecular Weight: 460 aa, 50 kDa\nObserved Molecular Weight: 42-46 kDa, 75-90 kDa,150 kDa\nGenBank Accession Number: BC012125\nGene Symbol: ZIP8\nGene ID (NCBI): 64116\nRRID: AB_10697830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C0K1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842643625,"sku":"20459-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20459-1-ap","provider":"Iright","version":"1.0","type":"link"}