{"product_id":"proteintech-20492-1-ap","title":"Proteintech, 20492-1-AP, C19orf50 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C19orf50 (20492-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf50 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20492-1-AP targets C19orf50 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-3 cells,  NCI-H1299 cells,  human placenta tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC19orf50, also known as KXD1 (KxDL motif-containing protein 1), a human uncharacterized coiled-coil protein, is a BLOS1-interacting protein. C19orf50 has been shown recently to interact with BLOC-1 subunits and may play a role in lysosome movement and localization at the cell periphery. C19orf50 was evaluated in NSCLC and  LUAD (PMID: 33936200, 22554196).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13743 Product name: Recombinant human C19orf50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC001080 Sequence: MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE Predict reactive species\nFull Name: chromosome 19 open reading frame 50\nCalculated Molecular Weight: 176 aa, 20 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC001080\nGene Symbol: C19orf50\nGene ID (NCBI): 79036\nRRID: AB_3669335\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQD3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885504123049,"sku":"20492-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20492-1-ap","provider":"Iright","version":"1.0","type":"link"}