{"product_id":"proteintech-20493-1-ap","title":"Proteintech, 20493-1-AP, NME2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NME2 (20493-1-AP) by Proteintech is a Polyclonal antibody targeting NME2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20493-1-AP targets NME2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  Jurkat cells,  mouse liver tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B) and NM23B, and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates, supplying nucleotide pools for DNA\/RNA synthesis, and interacts with membrane receptors and constitutes a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species\nFull Name: non-metastatic cells 2, protein (NM23B) expressed in\nCalculated Molecular Weight: 152 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC002476\nGene Symbol: NME2\nGene ID (NCBI): 4831\nRRID: AB_10695634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22392\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869476966569,"sku":"20493-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20493-1-ap","provider":"Iright","version":"1.0","type":"link"}