{"product_id":"proteintech-20505-1-ap","title":"Proteintech, 20505-1-AP, SNRNP27 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRNP27 (20505-1-AP) by Proteintech is a Polyclonal antibody targeting SNRNP27 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20505-1-AP targets SNRNP27 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse heart tissue,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNRNP27 also named U4\/U6.U5 small nuclear ribonucleoprotein 27 kDa protein. It is located in the cell nucleus. SNRNP27 may play a role in mRNA splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14308 Product name: Recombinant human SNRNP27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-155 aa of BC017890 Sequence: RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA Predict reactive species\nFull Name: small nuclear ribonucleoprotein 27kDa (U4\/U6.U5)\nCalculated Molecular Weight: 155 aa, 19 kDa\nObserved Molecular Weight: 23-27 kDa\nGenBank Accession Number: BC017890\nGene Symbol: SNRNP27\nGene ID (NCBI): 11017\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVK2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810793641,"sku":"20505-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20505-1-ap","provider":"Iright","version":"1.0","type":"link"}