{"product_id":"proteintech-20513-1-ap","title":"Proteintech, 20513-1-AP, SPON2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPON2 (20513-1-AP) by Proteintech is a Polyclonal antibody targeting SPON2 in WB, IHC, ELISA applications with reactivity to human samples\n20513-1-AP targets SPON2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells\nPositive IHC detected in: human prostate cancer tissue, human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPON2 (Spondin 2), also known as Mindin, is a member of the F-spondin family of secreted extracellular matrix proteins. This protein has been implicated in axon guidance, immune response and adhesion. SPON2 is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens (PMID: 14691481). It also functions as an integrin ligand for inflammatory cell recruitment and T-cell priming (PMID: 19153605). Besides, SPON2 has been reported as a prognostic biomarker for ovarian and prostate cancer (PMID: 17490732; 22615945; 23665271).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14337 Product name: Recombinant human SPON2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-221 aa of BC002707 Sequence: ESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHP Predict reactive species\nFull Name: spondin 2, extracellular matrix protein\nCalculated Molecular Weight: 331 aa, 36 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC002707\nGene Symbol: SPON2\nGene ID (NCBI): 10417\nRRID: AB_2878696\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUD6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989739177,"sku":"20513-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20513-1-ap","provider":"Iright","version":"1.0","type":"link"}