{"product_id":"proteintech-20540-1-ap","title":"Proteintech, 20540-1-AP, AXIN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AXIN2 (20540-1-AP) by Proteintech is a Polyclonal antibody targeting AXIN2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20540-1-AP targets AXIN2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, BxPC-3 cells,  HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAxis inhibition protein2 (AXIN2), also known as Coductin or Axil, is a multidomain scaffold protein that negatively regulate Wnt signaling. AXIN2 can directly interact  with beta-catenin and GSK3B. AXIN2 has a number of phosphorylation sites, and also can undergo poly(ADP-ribosy)lation by tankyrase TNKS and TNKS2. Poly(ADP-ribosy)lated AXIN2 then get unbiquitinated by RNF146 and leads to its degradation and subsequent activation of Wnt signaling. AXIN2 is localized in the cytoplasm and its mutation is involved in colorectal cancer. Catalgo#20540-1-AP is a rabbit polyclonal antibdy raised against a 34 amino acid N-terminal of human AXIN2. Observed MW of AXIN2 is from 93-100 kDa (PMID: 11809809; 24607787).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14574 Product name: Recombinant human AXIN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-83 aa of BC006295 Sequence: EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH Predict reactive species\nFull Name: axin 2\nCalculated Molecular Weight: 843 aa, 94 kDa\nObserved Molecular Weight: 94-100 kDa\nGenBank Accession Number: BC006295\nGene Symbol: AXIN2\nGene ID (NCBI): 8313\nRRID: AB_10694569\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2T1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840480937,"sku":"20540-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20540-1-ap","provider":"Iright","version":"1.0","type":"link"}