{"product_id":"proteintech-20613-1-ap","title":"Proteintech, 20613-1-AP, PORCN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PORCN (20613-1-AP) by Proteintech is a Polyclonal antibody targeting PORCN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20613-1-AP targets PORCN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: mouse brain tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPORCN is one of several related membrane-bound O-acyltransferase (MBOAT) enzymes encoding a 461 amino acid-sized (52 kDa) protein named porcupine located in the endoplasmic reticulum and known to be involved in the processing, secretion, and signaling of Wnt proteins (PMID: 17546031). Overexpression of PORCN could promote the proliferation and migration abilities of HCC cells both in vitro and in vivo (PMID: 37588740, 23188502).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14664 Product name: Recombinant human PORCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 258-348 aa of BC019080 Sequence: EATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLS Predict reactive species\nFull Name: porcupine homolog (Drosophila)\nCalculated Molecular Weight: 461 aa, 52 kDa\nObserved Molecular Weight: 43~50 kDa\nGenBank Accession Number: BC019080\nGene Symbol: PORCN\nGene ID (NCBI): 64840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H237\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887768719529,"sku":"20613-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20613-1-ap","provider":"Iright","version":"1.0","type":"link"}