{"product_id":"proteintech-20614-1-ap","title":"Proteintech, 20614-1-AP, PEX7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PEX7 (20614-1-AP) by Proteintech is a Polyclonal antibody targeting PEX7 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20614-1-AP targets PEX7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPEX7, also known as peroxisomal targeting signal 2 (PTS2) receptor, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively. PEX7 plays an essential role in peroxisomal protein import by binding to the N-terminal PTS2-type peroxisomal targeting signal. PEX7 defects are associated with peroxisome biogenesis disorder complementation group 11 (PBD-CG11), rhizomelic chondrodysplasia punctata type 1 (RCDP1) and Refsum disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14666 Product name: Recombinant human PEX7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-323 aa of BC006268 Sequence: GEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA Predict reactive species\nFull Name: peroxisomal biogenesis factor 7\nCalculated Molecular Weight: 323 aa, 36 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC006268\nGene Symbol: PEX7\nGene ID (NCBI): 5191\nRRID: AB_10694826\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00628\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869422211241,"sku":"20614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20614-1-ap","provider":"Iright","version":"1.0","type":"link"}