{"product_id":"proteintech-20615-1-ap","title":"Proteintech, 20615-1-AP, SLC25A40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A40 (20615-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A40 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n20615-1-AP targets SLC25A40 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, mouse kidney tissue,  mouse liver tissue\nPositive IHC detected in: human placenta tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:100-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A40 (solute carrier family 25, member 40) is one of the solute carrier (SLC) transporters that comprise a family of MCS transporters and uptakes GSH into mitochondria (PMID: 37407483). The SLC25A40 mRNA levels were significantly increased in both the kidneys of LPS mice and KMRC-1 cells after LPS treatment, when compared with those in the controls (PMID: 35955707).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14669 Product name: Recombinant human SLC25A40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC027322 Sequence: MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPT Predict reactive species\nFull Name: solute carrier family 25, member 40\nCalculated Molecular Weight: 338 aa, 38 kDa\nObserved Molecular Weight: 30~38 kDa\nGenBank Accession Number: BC027322\nGene Symbol: SLC25A40\nGene ID (NCBI): 55972\nRRID: AB_3669338\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TBP6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804895401,"sku":"20615-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20615-1-ap","provider":"Iright","version":"1.0","type":"link"}