{"product_id":"proteintech-20631-1-ap","title":"Proteintech, 20631-1-AP, WDR74 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR74 (20631-1-AP) by Proteintech is a Polyclonal antibody targeting WDR74 in WB, IHC, ELISA applications with reactivity to human samples\n20631-1-AP targets WDR74 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  MCF-7 cells,  L02 cells,  MDA-MB-231 cells\nPositive IHC detected in: human hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR74, also known as WD repeat domain 74, is a protein-coding gene that plays important roles in various biological processes. WDR74 is involved in rRNA processing and ribosomal large subunit biogenesis. It is a 60S ribosome assembly factor, which is irreplaceable in ribosome biogenesis and is closely related to protein synthesis. WDR74 can induce nuclear β-catenin accumulation and activate Wnt-responsive genes, thus promoting cell proliferation and metastasis in various cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14617 Product name: Recombinant human WDR74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006351 Sequence: MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN Predict reactive species\nFull Name: WD repeat domain 74\nCalculated Molecular Weight: 385 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC006351\nGene Symbol: WDR74\nGene ID (NCBI): 54663\nRRID: AB_2878713\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6RFH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887923155113,"sku":"20631-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20631-1-ap","provider":"Iright","version":"1.0","type":"link"}