{"product_id":"proteintech-20634-1-ap","title":"Proteintech, 20634-1-AP, CXCR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCR2 (20634-1-AP) by Proteintech is a Polyclonal antibody targeting CXCR2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples\n20634-1-AP targets CXCR2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, COLO 320 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL8RB, also named as CXCR2, GRO\/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO\/MGSA, and NAP-2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14670 Product name: Recombinant human IL-8RB\/CXCR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC037961 Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL Predict reactive species\nFull Name: interleukin 8 receptor, beta\nCalculated Molecular Weight: 360 aa, 41 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC037961\nGene Symbol: IL8RB\nGene ID (NCBI): 3579\nRRID: AB_10693624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25025\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857585833,"sku":"20634-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20634-1-ap","provider":"Iright","version":"1.0","type":"link"}