{"product_id":"proteintech-20640-1-ap","title":"Proteintech, 20640-1-AP, HERPUD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HERPUD2 (20640-1-AP) by Proteintech is a Polyclonal antibody targeting HERPUD2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n20640-1-AP targets HERPUD2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHERPUD2, also named as Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein, is a 406 amino acid protein, which contains one ubiquitin-like domain. HERPUD2 as a single-pass membrane protein could be involved in the unfolded protein response (UPR) pathway. HERPUD2 may exstis as two isoforms 406aa,45 kDa and 297aa 33 kDa (Genebank:EAW94050).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14702 Product name: Recombinant human HERPUD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC005091 Sequence: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH Predict reactive species\nFull Name: HERPUD family member 2\nCalculated Molecular Weight: 406 aa, 45 kDa\nObserved Molecular Weight: 35-45 kDa\nGenBank Accession Number: BC005091\nGene Symbol: HERPUD2\nGene ID (NCBI): 64224\nRRID: AB_2878714\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BSE4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869692448937,"sku":"20640-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20640-1-ap","provider":"Iright","version":"1.0","type":"link"}