{"product_id":"proteintech-20755-1-ap","title":"Proteintech, 20755-1-AP, ADAM20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM20 (20755-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM20 in WB, ELISA applications with reactivity to human, mouse samples\n20755-1-AP targets ADAM20 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM20 is the functional equivalent of sperm fertilin-alpha (ADAM1), since that gene is nonfunctional in human. And northern blot analysis detected the 2.8-kb ADAM20 mRNA only in testis. The exclusive expression of ADAM20 in human testis and their sequence similarity with the fertilins suggest that it is expressed on sperm cells and involved in sperm maturation and\/or fertilization(PMID:9469942). The full length protein has a singnal peptide, propeptide and 6 glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14493 Product name: Recombinant human ADAM20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 492-693 aa of BC025378 Sequence: HPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGTTYVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHLSQACQPKTCNMR Predict reactive species\nFull Name: ADAM metallopeptidase domain 20\nCalculated Molecular Weight: 776 aa, 87 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC025378\nGene Symbol: ADAM20\nGene ID (NCBI): 8748\nRRID: AB_3669344\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43506\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802090665,"sku":"20755-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20755-1-ap","provider":"Iright","version":"1.0","type":"link"}