{"product_id":"proteintech-20791-1-ap","title":"Proteintech, 20791-1-AP, GPR172B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR172B (20791-1-AP) by Proteintech is a Polyclonal antibody targeting GPR172B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20791-1-AP targets GPR172B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, mouse testis tissue,  rat testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR172B, also known as solute carrier family 52 member 1 (SLC52A1) or riboflavin transporter 1 (RFT1), is a G protein-coupled receptor (GPCR) that plays a significant role in the transport of riboflavin, a vital component for the production of flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). GPR172B plays a role in cellular aging. Knockdown of GPR172B promotes senescence induced by DNA damage in both tumor and normal cells. The anti-senescence effect of GPR172B is dependent on its riboflavin transport activity, which leads to the activation of mitochondrial membrane potential (MMP) mediated by mitochondrial electron transport chain complex II, ultimately inhibiting the AMPK-p53 pathway, a central mediator of senescence-associated with mitochondrial dysfunction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14525 Product name: Recombinant human GPR172B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-290 aa of BC060810 Sequence: TALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTS Predict reactive species\nFull Name: G protein-coupled receptor 172B\nCalculated Molecular Weight: 448 aa, 46 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC060810\nGene Symbol: GPR172B\nGene ID (NCBI): 55065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWF4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657111721,"sku":"20791-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20791-1-ap","provider":"Iright","version":"1.0","type":"link"}