{"product_id":"proteintech-20811-1-ap","title":"Proteintech, 20811-1-AP, TXNDC17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXNDC17 (20811-1-AP) by Proteintech is a Polyclonal antibody targeting TXNDC17 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20811-1-AP targets TXNDC17 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  human kidney tissue,  human uterus tissue,  Jurkat cells,  K-562 cells,  L02 cells,  mouse pancreas tissue\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXNDC17 also known as TRP14, TXNL5, belongs to the thioredoxin family. TRP14 is a widely expressed, 123-amino acid protein with a WCPDC motif. TXNDC17 has a thioredoxin fold and a TRX-like active-site sequence(PMID: 14607844, 24778250).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14766 Product name: Recombinant human TXNDC17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC006405 Sequence: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED Predict reactive species\nFull Name: thioredoxin domain containing 17\nCalculated Molecular Weight: 123 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC006405\nGene Symbol: TXNDC17\nGene ID (NCBI): 84817\nRRID: AB_10695499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869783511209,"sku":"20811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20811-1-ap","provider":"Iright","version":"1.0","type":"link"}